DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and reep5

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_956352.1 Gene:reep5 / 337237 ZFINID:ZDB-GENE-030131-9181 Length:189 Species:Danio rerio


Alignment Length:71 Identity:21/71 - (29%)
Similarity:30/71 - (42%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GTLLPGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLILSVGLWFS 74
            |.:.|.:.|::||....:.....||.|||:|.:...:....|..|....||...|....|  |..
Zfish    63 GFVYPAYISIKAIESPAKDDDTKWLTYWVVYGVFSVVEFFADIFLSWFPFYFLAKCAFLV--WCM 125

  Fly    75 APYSTN 80
            ||..:|
Zfish   126 APTPSN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 16/58 (28%)
reep5NP_956352.1 TB2_DP1_HVA22 67..144 CDD:460820 20/67 (30%)
Required for dimerization and maintaining endoplasmic reticulum morphology. /evidence=ECO:0000250|UniProtKB:Q00765 114..185 6/20 (30%)

Return to query results.
Submit another query.