DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and Reep4

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001020450.1 Gene:Reep4 / 306014 RGDID:1306561 Length:257 Species:Rattus norvegicus


Alignment Length:77 Identity:22/77 - (28%)
Similarity:42/77 - (54%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVYIYYGTLLPGWSSLRAI-GHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLI 66
            |||.:.:|.|.|.::|.:|: ..:.|.::. |:.||:::|:.......||..:....||..:|  
  Rat     8 RLVVLIFGMLYPAYASYKAVKSKNIREYVR-WMMYWIVFAIFMAAETFTDIFISWFPFYYEIK-- 69

  Fly    67 LSVGLWFSAPYS 78
            ::..||..:||:
  Rat    70 MAFVLWLLSPYT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 14/59 (24%)
Reep4NP_001020450.1 TB2_DP1_HVA22 19..94 CDD:460820 17/66 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..257
PRK11675 <211..>243 CDD:183272
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.