DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and Reep3

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001191844.1 Gene:Reep3 / 28193 MGIID:88930 Length:267 Species:Mus musculus


Alignment Length:77 Identity:20/77 - (25%)
Similarity:39/77 - (50%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVYIYYGTLLPGWSSLRAI-GHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLI 66
            |.|.:.:|.|.|.:.|.:|: ..:.:.::. |:.||:::||...:..:.|..|.....|..||:.
Mouse     8 RAVVLVFGMLYPAYYSYKAVKTKNVKEYVR-WMMYWIVFALYTVIETVADQTLAWFPLYYELKIA 71

  Fly    67 LSVGLWFSAPYS 78
            ..:  |..:||:
Mouse    72 FVI--WLLSPYT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 13/59 (22%)
Reep3NP_001191844.1 TB2_DP1_HVA22 19..95 CDD:460820 16/66 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..232
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.