DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and yop-1

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_491033.1 Gene:yop-1 / 171835 WormBaseID:WBGene00022127 Length:183 Species:Caenorhabditis elegans


Alignment Length:41 Identity:15/41 - (36%)
Similarity:24/41 - (58%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVYIYYGTLLPGWSSLRAIGHDQRHFIELWLKYWVIYALL 43
            :||..:.|.:.|.:.|::||....:.....||.||||:|:|
 Worm    61 QLVCNFMGFVYPAYMSIKAIESSNKEDDTQWLTYWVIFAIL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 12/30 (40%)
yop-1NP_491033.1 TB2_DP1_HVA22 72..147 CDD:460820 12/30 (40%)

Return to query results.
Submit another query.