DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and ReepB

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_317989.3 Gene:ReepB / 1278407 VectorBaseID:AGAMI1_004318 Length:181 Species:Anopheles gambiae


Alignment Length:71 Identity:20/71 - (28%)
Similarity:31/71 - (43%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GTLLPGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLILSVGLWFS 74
            |...|.:.|::||....:.....||.|||.:.:|......:.||:..:.||..||.:..:  |..
Mosquito    67 GVAYPAYISMKAIETRTKEDDTKWLTYWVTFGVLSVFEHFSFFLVQIIPFYWLLKCLFHI--WCM 129

  Fly    75 APYSTN 80
            .|...|
Mosquito   130 VPMENN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 16/58 (28%)
ReepBXP_317989.3 TB2_DP1_HVA22 71..148 CDD:460820 19/67 (28%)

Return to query results.
Submit another query.