DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPC300 and BRK1

DIOPT Version :9

Sequence 1:NP_001286810.1 Gene:HSPC300 / 246497 FlyBaseID:FBgn0061198 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_179849.2 Gene:BRK1 / 816795 AraportID:AT2G22640 Length:85 Species:Arabidopsis thaliana


Alignment Length:58 Identity:26/58 - (44%)
Similarity:42/58 - (72%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYLEACVA 70
            :..||.|||:|..|:.:::|:.:||..|:.:.:|:||.|||||.:||||::.||..|:
plant    17 VQADWENREFISHISLNVRRLFEFLVQFESTTKSKLASLNEKLDLLERRLEMLEVQVS 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPC300NP_001286810.1 CCDC53 34..>67 CDD:401961 16/32 (50%)
BRK1NP_179849.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3930
eggNOG 1 0.900 - - E1_2CHT7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2563
OMA 1 1.010 - - QHG54517
OrthoDB 1 1.010 - - D1579787at2759
OrthoFinder 1 1.000 - - FOG0006429
OrthoInspector 1 1.000 - - oto3578
orthoMCL 1 0.900 - - OOG6_106536
Panther 1 1.100 - - LDO PTHR33668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.