DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPC300 and Brk1

DIOPT Version :9

Sequence 1:NP_001286810.1 Gene:HSPC300 / 246497 FlyBaseID:FBgn0061198 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001182405.1 Gene:Brk1 / 679934 RGDID:1598136 Length:75 Species:Rattus norvegicus


Alignment Length:76 Identity:56/76 - (73%)
Similarity:68/76 - (89%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYL 65
            |:| ..:.:|::||||||||||||:||:|||:|:|||||||||||||||.||||||.|||||:|:
  Rat     1 MAG-QEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYI 64

  Fly    66 EACVAQGETLT 76
            ||.|.:|||||
  Rat    65 EARVTKGETLT 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPC300NP_001286810.1 CCDC53 34..>67 CDD:401961 27/32 (84%)
Brk1NP_001182405.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334682
Domainoid 1 1.000 116 1.000 Domainoid score I5798
eggNOG 1 0.900 - - E1_2CHT7
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10210
Inparanoid 1 1.050 117 1.000 Inparanoid score I4713
OMA 1 1.010 - - QHG54517
OrthoDB 1 1.010 - - D1579787at2759
OrthoFinder 1 1.000 - - FOG0006429
OrthoInspector 1 1.000 - - oto96479
orthoMCL 1 0.900 - - OOG6_106536
Panther 1 1.100 - - LDO PTHR33668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5388
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.