DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPC300 and brk1

DIOPT Version :9

Sequence 1:NP_001286810.1 Gene:HSPC300 / 246497 FlyBaseID:FBgn0061198 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001002097.1 Gene:brk1 / 415187 ZFINID:ZDB-GENE-040625-77 Length:75 Species:Danio rerio


Alignment Length:76 Identity:57/76 - (75%)
Similarity:67/76 - (88%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYL 65
            |:| ..:.:|::|||||||||||||||:|||:|.|||||||||||||||.||||||.|||||:|:
Zfish     1 MAG-QEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYI 64

  Fly    66 EACVAQGETLT 76
            ||.|.:|||||
Zfish    65 EARVTKGETLT 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPC300NP_001286810.1 CCDC53 34..>67 CDD:401961 27/32 (84%)
brk1NP_001002097.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5897
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10210
Inparanoid 1 1.050 117 1.000 Inparanoid score I4792
OMA 1 1.010 - - QHG54517
OrthoDB 1 1.010 - - D1579787at2759
OrthoFinder 1 1.000 - - FOG0006429
OrthoInspector 1 1.000 - - oto39793
orthoMCL 1 0.900 - - OOG6_106536
Panther 1 1.100 - - LDO PTHR33668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2987
SonicParanoid 1 1.000 - - X5388
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.970

Return to query results.
Submit another query.