DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPC300 and Brk1

DIOPT Version :9

Sequence 1:NP_001286810.1 Gene:HSPC300 / 246497 FlyBaseID:FBgn0061198 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_598698.1 Gene:Brk1 / 101314 MGIID:1915406 Length:75 Species:Mus musculus


Alignment Length:76 Identity:56/76 - (73%)
Similarity:68/76 - (89%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYL 65
            |:| ..:.:|::||||||||||||:||:|||:|:|||||||||||||||.||||||.|||||:|:
Mouse     1 MAG-QEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYI 64

  Fly    66 EACVAQGETLT 76
            ||.|.:|||||
Mouse    65 EARVTKGETLT 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPC300NP_001286810.1 CCDC53 34..>67 CDD:401961 27/32 (84%)
Brk1NP_598698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830970
Domainoid 1 1.000 116 1.000 Domainoid score I5922
eggNOG 1 0.900 - - E1_2CHT7
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10210
Inparanoid 1 1.050 117 1.000 Inparanoid score I4798
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54517
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006429
OrthoInspector 1 1.000 - - oto92925
orthoMCL 1 0.900 - - OOG6_106536
Panther 1 1.100 - - LDO PTHR33668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2987
SonicParanoid 1 1.000 - - X5388
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.