DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr60D and CG8927

DIOPT Version :10

Sequence 1:NP_726468.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:54 Identity:13/54 - (24%)
Similarity:24/54 - (44%) Gaps:11/54 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQLLKSENRQNLDGA---------GQFQHEITVSNGIQVKAQGNV--NGIQGEY 66
            :|.::....:|.||:         |.|:.|:..::.|.....|.|  :|.:.||
  Fly   259 SQTIRKWREENEDGSITWGYENDDGSFKEELIGTDCITKGTYGYVDPDGNKREY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr60DNP_726468.1 Chitin_bind_4 41..87 CDD:459790 8/28 (29%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 9/36 (25%)

Return to query results.
Submit another query.