DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr60D and Lcp3

DIOPT Version :9

Sequence 1:NP_001286853.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001260803.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:87 Identity:24/87 - (27%)
Similarity:42/87 - (48%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFVVLASCSEEDLQA-----QLLKSENRQNLDGAGQFQHEITVSNGIQVKAQGNVNG-IQGEYFL 68
            :|.:|..||...|.|     ::.:..|....||   |..::.:.:|....|.|:::| |.|.:..
  Fly     1 MFKILLVCSLAALVAANANVEVKELVNDVQPDG---FVSKLVLDDGSASSATGDIHGNIDGVFEW 62

  Fly    69 PGEDGKQIRVTYTADATGFHPK 90
            ...:|..:||:|.||..|:.|:
  Fly    63 ISPEGVHVRVSYKADENGYQPQ 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr60DNP_001286853.1 Chitin_bind_4 41..87 CDD:278791 13/46 (28%)
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.