DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr60D and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_726468.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:107 Identity:29/107 - (27%)
Similarity:51/107 - (47%) Gaps:21/107 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKYSLIF--ALFVVLASCSEEDLQAQ-------LLKSENRQNLDGAGQFQHEITVSNGIQVKAQG 57
            ::|:|:|  ||.:.||. :...::.|       :::.|...|.||:.::.:|  ..|||..:.:|
  Fly     1 MQYTLLFIAALLLSLAQ-ARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYE--TGNGINAEEEG 62

  Fly    58 NVNG---------IQGEYFLPGEDGKQIRVTYTADATGFHPK 90
            .:..         .||.:.....:|..||:||.||..||.|:
  Fly    63 YLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr60DNP_726468.1 Chitin_bind_4 41..87 CDD:459790 14/54 (26%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 14/56 (25%)

Return to query results.
Submit another query.