DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30160 and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:224 Identity:88/224 - (39%)
Similarity:140/224 - (62%) Gaps:10/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFV 65
            |:|..:|.||:|::.||:....||||||.|:::.|.:.|...|...:.||.:|:.:|::|::..:
  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILL 65

  Fly    66 VAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQG 130
            :::|||||.|||:.|.:..|:|.:.:|...||||.|:::...||:|..||..|:|||:...:...
  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSD 130

  Fly   131 YPMDALQLAFSCCGNTGYQQYE---TVPSSCCGYKDRTKVCEAE-IYSQRPGCRQEFVDFWASNT 191
            | |||:|::..|||.:||..|.   ..|.|||   ..|..|..| :|  |.||:..||:||..|:
  Fly   131 Y-MDAIQISMKCCGRSGYTDYAYQGKFPPSCC---SDTNNCRWETVY--RRGCKVTFVEFWDRNS 189

  Fly   192 DLIRWSSLIIALFELGIFIMSCCLASAMR 220
            |:|:::.|:||..|...|:.:||||:::|
  Fly   190 DIIKYAGLVIAAIEFVGFVFACCLANSIR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 84/214 (39%)
tetraspanin_LEL 104..191 CDD:239401 35/90 (39%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 84/214 (39%)
tetraspanin_LEL 104..188 CDD:239401 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.