DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30160 and Tsp47F

DIOPT Version :9

Sequence 1:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:238 Identity:61/238 - (25%)
Similarity:116/238 - (48%) Gaps:23/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFVV 66
            :|..::.||:|:..|::|...|:.:::.|:::|:.:..|..|..| .....||.:||.|.:.|::
  Fly     3 SCGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEG-RVLAPPIVLIVTGLIIFLI 66

  Fly    67 AFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAAN--DKFLSSMGK-AVDKAWDENNAA 128
            |..||.|.|:|:......:|:.:.::|.::||:.|   ||:  .|.|..|.| ::.::...:|:.
  Fly    67 ASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGI---AASVFKKDLEGMVKNSLQESIKRSNSE 128

  Fly   129 QGYPMDALQLAFSCCGNTGYQQY------ETVPSSCC--GYKDRT-------KVCEAEIYSQRPG 178
            .....|.:|....|||......:      :|:|.|||  .|.|.|       .....:.|.| .|
  Fly   129 DTMAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQ-VG 192

  Fly   179 CRQEFVDFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMRK 221
            |..:..|....|..::....:.||..::...:::|.||:::|:
  Fly   193 CVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 59/228 (26%)
tetraspanin_LEL 104..191 CDD:239401 25/104 (24%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 59/228 (26%)
uroplakin_I_like_LEL 102..205 CDD:239409 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.