DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30160 and Cd63

DIOPT Version :9

Sequence 1:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:248 Identity:76/248 - (30%)
Similarity:118/248 - (47%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVG---SIML-------STMGNFTAFDGGVNTQTIPIC 55
            |.|:    |:|||:|.|.|.|..:.||.:|   .::|       :|.|:.           :|:.
  Rat    31 MKCV----KFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSL-----------LPVV 80

  Fly    56 IIVIGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDK 120
            ||.:|:..|:|||.||||..:||.|....:||.:.::..:::|::|..:...|:..|...|:..|
  Rat    81 IIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQK 145

  Fly   121 AWD----ENNAAQGYPMDALQLAFSCCGNTGYQQYE--------TVPSSCC-----GYKDRTKVC 168
            ...    :|..|.  .:|.||....|||.:.|..:|        .||.|||     |..:..|  
  Rat   146 QMQNYLTDNKTAT--ILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFK-- 206

  Fly   169 EAEIYSQRPGCRQEFVDFWASNTDLIRWSSLIIALFE-LGIFIMSCCLASAMR 220
            |:.|::|  ||.:....:...|..|:..::|.||..| ||| |.||||..::|
  Rat   207 ESTIHTQ--GCVETIAAWLRKNVLLVAGAALGIAFVEVLGI-IFSCCLVKSIR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 73/238 (31%)
tetraspanin_LEL 104..191 CDD:239401 26/103 (25%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 74/243 (30%)
ATP-synt_A <72..131 CDD:294288 21/69 (30%)
CD63_LEL 129..227 CDD:239419 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.