DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30160 and Cd63

DIOPT Version :9

Sequence 1:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus


Alignment Length:248 Identity:75/248 - (30%)
Similarity:119/248 - (47%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVG---SIML-------STMGNFTAFDGGVNTQTIPIC 55
            |.|:    |:|||:|.|.|.|..:.||.:|   .::|       :|.|:.           :|:.
Mouse     7 MKCV----KFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSL-----------LPVV 56

  Fly    56 IIVIGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDK 120
            ||.:|:..|:|||.||||..:||.|....:||.:.::..:::|::|..:...|:..|...|:..:
Mouse    57 IIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQ 121

  Fly   121 AWD----ENNAAQGYPMDALQLAFSCCGNTGYQQYET--------VPSSCCGYKDRTKVC----- 168
            ...    :|..|.  .:|.||...:|||.:.|..:|.        ||.|||  .:.|..|     
Mouse   122 QMQNYLKDNKTAT--ILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCC--INITVGCGNDFK 182

  Fly   169 EAEIYSQRPGCRQEFVDFWASNTDLIRWSSLIIALFE-LGIFIMSCCLASAMR 220
            |:.|::|  ||.:....:...|..|:..::|.||..| ||| |.||||..::|
Mouse   183 ESTIHTQ--GCVETIAIWLRKNILLVAAAALGIAFVEVLGI-IFSCCLVKSIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 72/238 (30%)
tetraspanin_LEL 104..191 CDD:239401 25/103 (24%)
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 70/238 (29%)
CD63_LEL 105..203 CDD:239419 25/103 (24%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.