DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and AT3G48380

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001190032.1 Gene:AT3G48380 / 823996 AraportID:AT3G48380 Length:653 Species:Arabidopsis thaliana


Alignment Length:232 Identity:81/232 - (34%)
Similarity:118/232 - (50%) Gaps:37/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLEDPQGALTTPTEG---GRTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRRQGSSG 90
            ||:|..  :..|:.|   |...:.:|.:.|:||..||..|:||||.||:||:.|||.:.:..:|.
plant   430 LLKDVH--IGIPSSGVSEGVASIIQGSYEYYHYLQDGFDDSGWGCAYRSLQTIISWFRLQHYTSI 492

  Fly    91 HVPSIREIQQILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAKELSS-DEILGELR 154
            .|||.|||||.||.||||.|.|||||:|||.:|..:|:|.|..|.|||::.:..|. .|...||.
plant   493 SVPSHREIQQTLVEIGDKDPSFVGSREWIGAIELSFVLDKLLGVSCKIMNFRSGSELPEKCRELA 557

  Fly   155 SYFEKYQGFVAMGGLSDTASKAITGY-------------HCSARGRIFLQVVDPHFVGVPSSRQH 206
            .:||.....:.:|.:..:..:....|             .|:     || ::|||:.|   |..|
plant   558 MHFENQGTPIMIGSVDQSLMRFKETYKKDPFNLLNFVFGDCA-----FL-ILDPHYTG---SEDH 613

  Fly   207 --LIDLGYVRWVPVDEFAGST-------YNLCLILQP 234
              :::.|:..|....:..|.:       |||.|..:|
plant   614 KKIVNGGWCGWKKAVDSKGKSFFLHNKFYNLLLPQRP 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 73/207 (35%)
AT3G48380NP_001190032.1 Peptidase_C78 446..645 CDD:285191 73/207 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2433
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D444004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102601
Panther 1 1.100 - - O PTHR48153
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.