DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and UFSP2

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_060829.2 Gene:UFSP2 / 55325 HGNCID:25640 Length:469 Species:Homo sapiens


Alignment Length:226 Identity:78/226 - (34%)
Similarity:112/226 - (49%) Gaps:24/226 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YAYP-------LLEDPQGALTTPT-EGGRTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISW 81
            |.:|       .:.:|...|..|. |.|...|.:|.:.|.||..|...|.||||.||:||:..||
Human   249 YHFPDEPYKDGYIRNPHTYLNPPNMETGMIYVVQGIYGYHHYMQDRIDDNGWGCAYRSLQTICSW 313

  Fly    82 IQRRQGSSGHVPSIREIQQILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAKELSS 146
            .:.:..:...:|:.|||||.||..|||...|||||.|||::|...|::.|..:..|||...:.|.
Human   314 FKHQGYTERSIPTHREIQQALVDAGDKPATFVGSRQWIGSIEVQLVLNQLIGITSKILFVSQGSE 378

  Fly   147 DEILG-ELRSYFEKYQGFVAMGG--LSDT----ASKAITGYHCSARGRIFLQVVDPHFVGVPSSR 204
            ....| ||.::|:.....|.:||  |:.|    |...||       |:|...::|||:.|. ...
Human   379 IASQGRELANHFQSEGTPVMIGGGVLAHTILGVAWNEIT-------GQIKFLILDPHYTGA-EDL 435

  Fly   205 QHLIDLGYVRWVPVDEF-AGSTYNLCLILQP 234
            |.:::.|:..|...|.: ..:.|||||..:|
Human   436 QVILEKGWCGWKGPDFWNKDAYYNLCLPQRP 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 68/192 (35%)
UFSP2NP_060829.2 Peptidase_C78 276..461 CDD:369589 68/192 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2433
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D444004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102601
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.