DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and UFSP1

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001015072.2 Gene:UFSP1 / 402682 HGNCID:33821 Length:142 Species:Homo sapiens


Alignment Length:136 Identity:49/136 - (36%)
Similarity:64/136 - (47%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IGDKGPEFVGSRDWIGTLEEFYVI-------DVLHQVPCKI-LHAKELSSDEILGELRSYFEKYQ 161
            :|||.|.|.|||||||.:|....:       ..|..||..: ||.:       |..|.|:|....
Human     1 MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGE-------LERLYSHFAGGG 58

  Fly   162 GFVAMGGLSDTASKAITGYHCSARGRIFLQVVDPHFVGVPSSRQHLIDLGYVRWVPVDEF--AGS 224
            |.|.:||.:|..|||:.|....:....::.|:|||:.|.|.|...|...|:|.|..|...  ..|
Human    59 GPVMVGGDADARSKALLGVCVGSGTEAYVLVLDPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNS 123

  Fly   225 TYNLCL 230
            .|||||
Human   124 FYNLCL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 46/133 (35%)
UFSP1NP_001015072.2 Peptidase_C78 <1..128 CDD:285191 46/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2433
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5349
Isobase 1 0.950 - 0 Normalized mean entropy S6143
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D444004at2759
OrthoFinder 1 1.000 - - FOG0009574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102601
Panther 1 1.100 - - LDO PTHR48153
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4815
SonicParanoid 1 1.000 - - X7326
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.