DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and CG16979

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_648779.1 Gene:CG16979 / 39687 FlyBaseID:FBgn0036512 Length:607 Species:Drosophila melanogaster


Alignment Length:217 Identity:72/217 - (33%)
Similarity:104/217 - (47%) Gaps:20/217 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PLLEDPQGALTTPTEGGRTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRRQGSSGHV 92
            |||....|...:....|:..:..|.::|:||.....||.||||.||:||:..||...:..::..:
  Fly   398 PLLNTHIGLRPSGVVDGKEYLVNGNYHYYHYLQQQVQDKGWGCAYRSLQTICSWFVLQGYTNAPI 462

  Fly    93 PSIREIQQILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILH---AKELSSDEILGELR 154
            |:..|:|:.|..|.||...||||..|||:.|....:.....|..||||   ..||::  |..||.
  Fly   463 PTHLEVQEYLHKINDKPAAFVGSSQWIGSTEISMCLQGFLNVDSKILHVASGAELAT--IASELA 525

  Fly   155 SYFEKYQGFVAMGGLSDTASKAITGYHCSARGRIFLQVVDPHFVGVPSSRQHLIDL------GYV 213
            .:|:. ||...|.|....|...|...:|...|::...::|||:.|..       ||      |:.
  Fly   526 MHFQT-QGTPVMIGGGVLAHTIIGVDYCVQTGQVKFLILDPHYTGAD-------DLATIQIKGWC 582

  Fly   214 RWVPVDEFA-GSTYNLCLILQP 234
            .|..:|.:| ||.||||:..:|
  Fly   583 GWKGMDFWAKGSYYNLCMPQRP 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 65/194 (34%)
CG16979NP_648779.1 Peptidase_C78 414..599 CDD:285191 65/194 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2433
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103745at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102601
Panther 1 1.100 - - P PTHR48153
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.