DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and Ufsp2

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001014164.1 Gene:Ufsp2 / 361151 RGDID:1311161 Length:461 Species:Rattus norvegicus


Alignment Length:221 Identity:74/221 - (33%)
Similarity:111/221 - (50%) Gaps:14/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YAYP-------LLEDPQGALTTPT-EGGRTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISW 81
            |.:|       .:.:|...|:.|. ||....:.:|.:.|.||..:...|.||||.||:||:..||
  Rat   241 YHFPDELYKDGYIRNPHAYLSPPNIEGSMICMVQGTYAYHHYMQNRVDDNGWGCAYRSLQTVCSW 305

  Fly    82 IQRRQGSSGHVPSIREIQQILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAKELSS 146
            .:.:..:...:|:.|||||.||..|||...|||||.|||::|...|::.|..|..|||...:.|.
  Rat   306 FRHQGYTERAIPTHREIQQALVDAGDKPATFVGSRQWIGSIEVQLVLNQLIGVTSKILFVNQGSE 370

  Fly   147 DEILG-ELRSYFEKYQGFVAMGGLSDTASKAITGYHCS-ARGRIFLQVVDPHFVGVPSSRQHLID 209
            ....| ||.::|:.....|.:||  ...:..|.|...: ..|:|...::|||:.|. ...|.:::
  Rat   371 MASQGRELANHFQNVGTPVMIGG--GVLAHTILGVAWNETTGQIKFLILDPHYTGA-EDLQVILE 432

  Fly   210 LGYVRWVPVDEF-AGSTYNLCLILQP 234
            .|:..|...|.: ..:.|||||..:|
  Rat   433 KGWCGWKGPDFWNKDAYYNLCLPQRP 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 63/187 (34%)
Ufsp2NP_001014164.1 Peptidase_C78 272..453 CDD:285191 63/183 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2433
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D444004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102601
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.