DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and ufsp2

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_005168394.1 Gene:ufsp2 / 336782 ZFINID:ZDB-GENE-030131-8726 Length:466 Species:Danio rerio


Alignment Length:218 Identity:79/218 - (36%)
Similarity:109/218 - (50%) Gaps:11/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DYAYP--LLEDPQGALTTPT-EGGRTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRR 85
            |.||.  .|.:|...|..|. |..:..:.:|.::|.||..|...|.||||.||:||:..||.|::
Zfish   250 DEAYKDGYLRNPHIHLNPPNIEDAKLYLVQGVYSYHHYMQDRVDDDGWGCAYRSLQTICSWFQQQ 314

  Fly    86 QGSSGHVPSIREIQQILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAKELSSDEIL 150
            ......||:..:|||.||.:|||.|.|||||.|||::|...|::.|..|..||:...:.|.....
Zfish   315 GYVETAVPTHTQIQQALVDVGDKEPRFVGSRQWIGSIEVQAVLNQLLGVTSKIMFVSQGSELATK 379

  Fly   151 G-ELRSYFEKYQGFVAMGGLSDTASKAITGYHCSAR-GRIFLQVVDPHFVGVPSSRQHLIDLGYV 213
            | ||.::|......|.:||  ...:..|.|...|.. |.|...::|||:.| ....|.:.|.|:.
Zfish   380 GRELANHFHTEGTPVMIGG--GVLAHTILGVAWSENTGEIRFLILDPHYTG-GEDLQIITDKGWC 441

  Fly   214 RWVPVDEF--AGSTYNLCLILQP 234
            .| ...||  ..:.|||||..:|
Zfish   442 GW-KGPEFWDQNAYYNLCLPQRP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 67/188 (36%)
ufsp2XP_005168394.1 Peptidase_C78 273..458 CDD:285191 67/188 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2433
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D444004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102601
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.