DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and ufsp2

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001120460.1 Gene:ufsp2 / 100145557 XenbaseID:XB-GENE-5850297 Length:464 Species:Xenopus tropicalis


Alignment Length:220 Identity:77/220 - (35%)
Similarity:113/220 - (51%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KDYAYPLLEDPQGALTT-PTEGGRTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRRQ 86
            :.|....:.:|...|:| |.||....:.:|.::|.||..|...|.||||.||:||:..||.:.:.
 Frog   249 EQYKDGYIRNPHLQLSTPPLEGATVSLVQGLYSYHHYMQDRMDDNGWGCAYRSLQTICSWFKYQG 313

  Fly    87 GSSGHVPSIREIQQILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKIL---HAKELSSDE 148
            .:...:|:.::|||.||.:|||...|||||.|||::|...|:|.|..:..||:   ...||:|..
 Frog   314 YTDKPIPTHKQIQQALVDVGDKPASFVGSRQWIGSVEVQLVLDQLLGITSKIMFVSQGTELASRG 378

  Fly   149 ILGELRSYFEKYQGFVAMGGLSDTASKAITGYHCS-ARGRIFLQVVDPHFVGVPSSRQHLI-DLG 211
              .||.::|......|.:||  ...:..|.|...| ..|.|...::|||:.|  ....|:| :.|
 Frog   379 --RELVNHFTSEGTPVMIGG--GVLAHTILGVAWSETTGDIRFLILDPHYKG--GEDLHVILEKG 437

  Fly   212 YVRWVPVDEF--AGSTYNLCLILQP 234
            :..| ...||  |.:.|||||..:|
 Frog   438 WCGW-KGPEFWEADAYYNLCLPQRP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 66/191 (35%)
ufsp2NP_001120460.1 Peptidase_C78 271..456 CDD:285191 66/191 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D444004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.