DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30157 and ufsp1

DIOPT Version :9

Sequence 1:NP_001286151.1 Gene:CG30157 / 246489 FlyBaseID:FBgn0050157 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001082999.1 Gene:ufsp1 / 100037378 ZFINID:ZDB-GENE-070410-124 Length:248 Species:Danio rerio


Alignment Length:193 Identity:88/193 - (45%)
Similarity:110/193 - (56%) Gaps:8/193 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRRQG-SSGHVPSIREIQQILVAIGDK 108
            |..|..|...|:||||||..|.||||||||:|:..||:...|. |..|.|||.||||.||.||||
Zfish    55 RCSVISGECLYYHYGCDGKDDRGWGCGYRTIQTISSWLCLNQPVSVRHPPSISEIQQTLVEIGDK 119

  Fly   109 GPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAK---ELSSDEILGELRSYFEKYQGFVAMGGLS 170
            ...|:|||:||||.|...|:|.|:.|||:|:|.:   ||  |:.:.:|.::|......|.|||..
Zfish   120 PDSFLGSREWIGTFEASLVLDQLYDVPCRIVHVRYGGEL--DQAVEDLHNHFLTRGSPVMMGGER 182

  Fly   171 DTASKAITGYHCSARGRIFLQVVDPHFVGVPSSRQHLIDLGYVRWVPVDEF-AGSTYNLCLIL 232
            |.:||.|.|...|..|. :|.|:|||:.|....:..|...|...|.||... ..|.||:||.|
Zfish   183 DNSSKGILGVSTSKHGS-YLLVMDPHYYGCALDKNTLQAQGRASWKPVSSLDQCSFYNICLPL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30157NP_001286151.1 Peptidase_C78 44..229 CDD:285191 85/188 (45%)
ufsp1NP_001082999.1 Peptidase_C78 54..241 CDD:285191 85/188 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581226
Domainoid 1 1.000 153 1.000 Domainoid score I4270
eggNOG 1 0.900 - - E1_KOG2433
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H80966
Inparanoid 1 1.050 156 1.000 Inparanoid score I4262
OMA 1 1.010 - - QHG49948
OrthoDB 1 1.010 - - D444004at2759
OrthoFinder 1 1.000 - - FOG0009574
OrthoInspector 1 1.000 - - oto40074
orthoMCL 1 0.900 - - OOG6_102601
Panther 1 1.100 - - LDO PTHR48153
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4815
SonicParanoid 1 1.000 - - X7326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.