powered by:
Protein Alignment CG30156 and SIS1
DIOPT Version :9
Sequence 1: | NP_001260752.1 |
Gene: | CG30156 / 246488 |
FlyBaseID: | FBgn0050156 |
Length: | 358 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014391.1 |
Gene: | SIS1 / 855725 |
SGDID: | S000004952 |
Length: | 352 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 60 |
Identity: | 26/60 - (43%) |
Similarity: | 36/60 - (60%) |
Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 YEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYN 157
|::|.:|..|...|:|:.|.|.||:.||| |..|..:.|:.||||.:.|.|.|||..|:
Yeast 8 YDLLGVSPSANEQELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDPQKREIYD 65
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30156 | NP_001260752.1 |
DnaJ |
96..157 |
CDD:278647 |
25/58 (43%) |
DUF1977 |
237..334 |
CDD:286411 |
|
SIS1 | NP_014391.1 |
DnaJ |
2..350 |
CDD:223560 |
26/60 (43%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.