DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and HLJ1

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:63/230 - (27%)
Similarity:98/230 - (42%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FTLEMLDVVQKVLRCRNH--YEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISE 142
            ||.:...:..::|....|  ||:|::...||.||:|:||.|||::||||||..|.|.:||:.|:.
Yeast     3 FTEDQEKIALEILSKDKHEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINR 67

  Fly   143 AADCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEF-NEANGNDLGAAFRRPY---RGANQ 203
            |.:.|::.:||..|:   .:|  .|.|..|.......|.| ..|.|:.:|..|...:   |...|
Yeast    68 AFEVLSNEEKRSIYD---RIG--RDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFFNSRFGGQ 127

  Fly   204 RMPQRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAP---------AYSFTLTRTHSARRLSRTNH 259
            |....:.::.             |||..    .|:|         |.:|:.......|..:....
Yeast   128 RAGPPEDIFD-------------FLFNA----GGSPFGASPFGPSASTFSFGGPGGFRVYTNNRG 175

  Fly   260 IAYYMNPTTLSKYTEQQLAELEVEIEEVYISDLKH 294
            .:.:|.....|:..:||..|..|.      |.||:
Yeast   176 GSPFMRQQPRSRQQQQQAEENAVN------SQLKN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 29/62 (47%)
DUF1977 237..334 CDD:286411 14/67 (21%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 47/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I1517
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.