DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and AT1G10350

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_172506.1 Gene:AT1G10350 / 837574 AraportID:AT1G10350 Length:349 Species:Arabidopsis thaliana


Alignment Length:112 Identity:33/112 - (29%)
Similarity:56/112 - (50%) Gaps:13/112 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN--KSPGAEQAFRRISEAADCLTDCQKRIEY-- 156
            ::|.||:::.:|...::|::|.::|::.|||||  ....||..|::||||.|.|:|.|:|..|  
plant     4 DYYNVLKVNRNANEDDLKKSYRRMAMKWHPDKNPTSKKEAEAKFKQISEAYDVLSDPQRRQIYDQ 68

  Fly   157 ---------NIATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAF 194
                     ::.||......|....|.....|..:...:..|:.|.|
plant    69 YGEEGLKSTDLPTAAETAAHQQQRSYSSSNSEFRYYPRDAEDIFAEF 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 33/112 (29%)
DnaJ 96..157 CDD:395170 25/73 (34%)
DUF1977 238..334 CDD:462754
AT1G10350NP_172506.1 DnaJ_bact 4..343 CDD:274090 33/112 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.