DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and AT5G05750

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_196194.1 Gene:AT5G05750 / 830459 AraportID:AT5G05750 Length:294 Species:Arabidopsis thaliana


Alignment Length:219 Identity:55/219 - (25%)
Similarity:108/219 - (49%) Gaps:31/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LRLKGEAQRTIGPTRKSDALPHKFTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLAL 121
            ||.:|.:....|.:..|.:     |.|...:|:::...:::||:|.:..:.:..:::::|.||:|
plant    80 LRQRGSSSSAAGSSSSSSS-----TEEQRTIVREIKSKKDYYEILGLKSNCSVEDLRKSYRKLSL 139

  Fly   122 RLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPSQ-YKDYRGESEFN-- 183
            ::||||||:||:|:||:.:|:|..||::...|.:|:     |...|:...| .:|.|..:.||  
plant   140 KVHPDKNKAPGSEEAFKSVSKAFQCLSNEDTRRKYD-----GSGSDEPAYQPRRDARRNNGFNGF 199

  Fly   184 -----EAN--------GNDLGAA---FRRPYRGANQRMPQRQSLYQTQQLVIGVVAALVFLFVTM 232
                 :|:        |.::..|   ||....|...|...:.|.......|:..:..:||:.:..
plant   200 YDDEFDADEIFRSFFGGGEMNPATTQFRSFNFGGGTRTANQASDTGFNPRVLLQILPVVFILLLN 264

  Fly   233 HFIAGAPAYSFT--LTRTHSARRL 254
            ...:..|.||.:  :|.:.::.|:
plant   265 FLPSPQPIYSLSHRITTSSNSPRI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 23/60 (38%)
DUF1977 237..334 CDD:286411 5/20 (25%)
AT5G05750NP_196194.1 DnaJ 110..>217 CDD:223560 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 1 1.000 - - FOG0001005
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43908
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.