DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and AT3G47940

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_190377.1 Gene:AT3G47940 / 823949 AraportID:AT3G47940 Length:350 Species:Arabidopsis thaliana


Alignment Length:115 Identity:41/115 - (35%)
Similarity:66/115 - (57%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKS---PGAEQAFRRISEAADCLTDCQKRIEYN 157
            ::|.:|:::|:||..::|:||.:||:..|||||.|   ..||..|:|||||.|.|:|.|||..|:
plant     4 DYYNILKVNHNATEDDLKKAYKRLAMIWHPDKNPSTRRDEAEAKFKRISEAYDVLSDPQKRQIYD 68

  Fly   158 IATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGANQRMPQ 207
            :....|....:.|:        |..:||:.:...::.|.|:  .:|..||
plant    69 LYGEEGLKSGKIPN--------SSSSEASSSSSSSSSRYPH--FHQHRPQ 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 41/115 (36%)
DnaJ 96..157 CDD:395170 30/63 (48%)
DUF1977 238..334 CDD:462754
AT3G47940NP_190377.1 DnaJ_bact 4..339 CDD:274090 41/115 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.