DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and AT3G08910

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_187503.1 Gene:AT3G08910 / 820040 AraportID:AT3G08910 Length:323 Species:Arabidopsis thaliana


Alignment Length:118 Identity:41/118 - (34%)
Similarity:62/118 - (52%) Gaps:12/118 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDK--NKSPGAEQAFRRISEAADCLTDCQKRIEYNI 158
            ::|:||::..:|...::|:||.|||::.||||  |....||..|::||||.|.|:|.|||..|:.
plant     4 DYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAIYDQ 68

  Fly   159 ATAVGDCHDQDP----SQYKDYRGESEFNEANGNDLGA---AFRRPY---RGA 201
            ....|......|    ..:.|......||..:.:|:.:   .|.||:   |||
plant    69 YGEEGLTSQAPPPGAGGGFSDGGASFRFNGRSADDIFSEFFGFTRPFGDSRGA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 41/118 (35%)
DnaJ 96..157 CDD:395170 28/62 (45%)
DUF1977 238..334 CDD:462754
AT3G08910NP_187503.1 PTZ00037 5..320 CDD:240236 41/117 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.