DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and AT2G35540

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_181097.2 Gene:AT2G35540 / 818119 AraportID:AT2G35540 Length:590 Species:Arabidopsis thaliana


Alignment Length:132 Identity:33/132 - (25%)
Similarity:60/132 - (45%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAV 162
            |:||::...:..:.:|:.|.||||.||||||...|.|:.|:.::||....:|..:|.||::...:
plant    73 YKVLKVEPFSHINTIKQQYRKLALVLHPDKNPYVGCEEGFKLLNEAFRVFSDKVRRTEYDMKLRI 137

  Fly   163 GDCHDQDPSQYKDYRGESEFNEANGNDLGA------------AFRRPYRGANQRMPQRQSLYQTQ 215
                        ..:||.....:.|::...            .|.|.|.|.|...|..::.::.:
plant   138 ------------RIQGEMVSGGSGGDETSTFSAVCSGCRSVHKFDRKYLGQNLMCPTCKNSFEAK 190

  Fly   216 QL 217
            ::
plant   191 EV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 33/132 (25%)
DnaJ 96..157 CDD:395170 23/58 (40%)
DUF1977 238..334 CDD:462754
AT2G35540NP_181097.2 DnaJ 71..132 CDD:395170 23/58 (40%)
DUF3444 362..565 CDD:463398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.