DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and AT2G25560

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_180126.1 Gene:AT2G25560 / 817094 AraportID:AT2G25560 Length:656 Species:Arabidopsis thaliana


Alignment Length:145 Identity:46/145 - (31%)
Similarity:67/145 - (46%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ALPHKFTLEMLD-VVQKV------LRCRN-------HYEVLRISHHATYSEVKRAYHKLALRLHP 125
            ||..:|....|| :.|.|      |..:|       ||.||.::..|....|::.|.|||:.|||
plant    31 ALKAQFLYPELDGIAQMVATFDVHLSAQNIIYGDVDHYGVLGLNPEADDEIVRKRYRKLAVMLHP 95

  Fly   126 DKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANGNDL 190
            |:|||.|||:||:.:|:|....:|..||.:|::...||           .|:|.           
plant    96 DRNKSVGAEEAFKFLSQAWGVFSDKAKRADYDLKRNVG-----------LYKGG----------- 138

  Fly   191 GAAFRRPYRGANQRM 205
            ||:..||.....|::
plant   139 GASSSRPATNGFQKV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 38/118 (32%)
DnaJ 96..157 CDD:395170 28/67 (42%)
DUF1977 238..334 CDD:462754
AT2G25560NP_180126.1 DnaJ 66..127 CDD:395170 27/60 (45%)
DUF3444 423..627 CDD:463398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.