DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnajc11

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001072583.1 Gene:dnajc11 / 780038 XenbaseID:XB-GENE-942676 Length:559 Species:Xenopus tropicalis


Alignment Length:67 Identity:24/67 - (35%)
Similarity:39/67 - (58%) Gaps:4/67 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSP----GAEQAFRRISEAADCLTDCQKRIEY 156
            ::|.:|.:...||..|:|.:|.:|.:..||||::.|    .|||.|..:.:|.:.|:|.|.|..|
 Frog    14 DYYSLLNVRREATQEELKASYRRLCMLYHPDKHRDPELKKQAEQLFNLVHQAYEVLSDPQSRAIY 78

  Fly   157 NI 158
            :|
 Frog    79 DI 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 22/64 (34%)
DUF1977 237..334 CDD:286411
dnajc11NP_001072583.1 DnaJ 14..79 CDD:365959 22/64 (34%)
DUF3395 410..549 CDD:371774
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.