Sequence 1: | NP_001260752.1 | Gene: | CG30156 / 246488 | FlyBaseID: | FBgn0050156 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571705.1 | Gene: | dnajc3b / 58154 | ZFINID: | ZDB-GENE-000831-4 | Length: | 502 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 45/205 - (21%) |
---|---|---|---|
Similarity: | 74/205 - (36%) | Gaps: | 64/205 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 HHCVDKVVSDLCLGHYEHALRQINEDLEGLQNHDEIMALLELKNIILRLRLKGEAQRTIGPTRKS 73
Fly 74 DALPHKFTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPG----AE 134
Fly 135 QAFRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRR--- 196
Fly 197 ----PYRGAN 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30156 | NP_001260752.1 | DnaJ | 96..157 | CDD:278647 | 23/64 (36%) |
DUF1977 | 237..334 | CDD:286411 | |||
dnajc3b | NP_571705.1 | TPR_11 | 41..107 | CDD:290150 | |
TPR repeat | 42..70 | CDD:276809 | |||
TPR repeat | 75..105 | CDD:276809 | |||
TPR_11 | 77..141 | CDD:290150 | |||
TPR repeat | 110..137 | CDD:276809 | |||
TPR repeat | 157..184 | CDD:276809 | |||
TPR_11 | 189..254 | CDD:290150 | |||
TPR repeat | 190..218 | CDD:276809 | |||
TPR repeat | 223..253 | CDD:276809 | |||
TPR repeat | 303..337 | CDD:276809 | |||
TPR repeat | 342..370 | CDD:276809 | 6/26 (23%) | ||
TPR | 348..375 | CDD:197478 | 6/26 (23%) | ||
DnaJ | 394..>500 | CDD:223560 | 32/120 (27%) | ||
DnaJ | 396..461 | CDD:278647 | 23/64 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |