DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajb2

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_036008391.1 Gene:Dnajb2 / 56812 MGIID:1928739 Length:365 Species:Mus musculus


Alignment Length:61 Identity:15/61 - (24%)
Similarity:31/61 - (50%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 MNPTTLSKYTEQQLAELE-VEIEEVY-ISDLKHKCRQERSWRDNLFLRARQGNNDQKLLQH 322
            :.||:||:..:..|:|.| :::...| :|:::...::....|.     |:|..:.|...||
Mouse   277 VRPTSLSRPPDHDLSEDEDLQLAMAYSLSEMEAAGQKPAGGRG-----AQQRQHGQPKAQH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647
DUF1977 237..334 CDD:286411 15/61 (25%)
Dnajb2XP_036008391.1 PRK14294 102..>151 CDD:237664
UIM 291..310 CDD:197845 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.