DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajb8

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_064348.1 Gene:Dnajb8 / 56691 MGIID:1922801 Length:227 Species:Mus musculus


Alignment Length:106 Identity:37/106 - (34%)
Similarity:56/106 - (52%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN--KSPGAEQAFRRISEAADCLTDCQKRIEYNI 158
            |:||||.:...|:..::|:||.|||||.|||||  ....||:.|:::|||.:.|:|.:||..|  
Mouse     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVY-- 65

  Fly   159 ATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYR 199
                      |.:....:|.....|..:.:..||.:  |:|
Mouse    66 ----------DRAGCDRWRAGGGANVPHSSPFGAGY--PFR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 37/106 (35%)
DnaJ 96..157 CDD:395170 29/62 (47%)
DUF1977 238..334 CDD:462754
Dnajb8NP_064348.1 PRK10767 1..>106 CDD:236757 37/106 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.