DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnajb2

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001073462.1 Gene:dnajb2 / 561686 ZFINID:ZDB-GENE-061013-537 Length:389 Species:Danio rerio


Alignment Length:114 Identity:35/114 - (30%)
Similarity:53/114 - (46%) Gaps:30/114 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN--KSPGAEQAFRRISEAADCLTDCQKRIEYNI 158
            ::|:||.:|..|:..::|:||.||||:.|||||  ....||:.|:.|:||.:.|:|..||.:|  
Zfish     3 DYYDVLGVSRSASPDDIKKAYRKLALQWHPDKNPDNKEEAEKKFKEIAEAYEVLSDKSKRDDY-- 65

  Fly   159 ATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGA----------AFRRP 197
                            |..|.|:...:.....|:          .||.|
Zfish    66 ----------------DRYGRSDMPSSGSGSSGSFPDDFPGFTFTFRSP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 35/114 (31%)
DnaJ 96..157 CDD:395170 27/62 (44%)
DUF1977 238..334 CDD:462754
dnajb2NP_001073462.1 DnaJ_bact 3..>108 CDD:274090 35/114 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.