DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and DNAJC3

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_011519406.1 Gene:DNAJC3 / 5611 HGNCID:9439 Length:533 Species:Homo sapiens


Alignment Length:163 Identity:39/163 - (23%)
Similarity:69/163 - (42%) Gaps:54/163 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YEHALRQINEDLEGLQNHDE----IMALLELKNIILRLRLKGEAQRTIGPTRKSDALPHKFTLEM 84
            |:.|:    :|.|..|.|:|    |...||            :|||.:..::|            
Human   385 YDEAI----QDYETAQEHNENDQQIREGLE------------KAQRLLKQSQK------------ 421

  Fly    85 LDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPD----KNKSPGAEQAFRRISEAAD 145
                      |::|::|.:..:|...|:.:||.||||:.|||    :.:...||:.|..|:.|.:
Human   422 ----------RDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKE 476

  Fly   146 CLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRG 178
            .|:|.:.|.:::        ..:||...:..:|
Human   477 VLSDPEMRKKFD--------DGEDPLDAESQQG 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 21/64 (33%)
DUF1977 237..334 CDD:286411
DNAJC3XP_011519406.1 TPR_11 36..100 CDD:290150
TPR repeat 37..65 CDD:276809
TPR repeat 70..100 CDD:276809
TPR_11 73..132 CDD:290150
TPR repeat 105..132 CDD:276809
TPR_11 182..246 CDD:290150
TPR repeat 186..211 CDD:276809
TPR_11 216..281 CDD:290150
TPR repeat 216..246 CDD:276809
TPR repeat 251..279 CDD:276809
TPR repeat 285..309 CDD:276809
TPR repeat 330..364 CDD:276809
TPR_19 347..411 CDD:291240 10/41 (24%)
TPR_1 369..402 CDD:278916 7/20 (35%)
TPR repeat 369..397 CDD:276809 4/15 (27%)
TPR repeat 403..426 CDD:276809 8/56 (14%)
DnaJ 421..>527 CDD:223560 26/111 (23%)
DnaJ 423..488 CDD:278647 21/64 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.