Sequence 1: | NP_001260752.1 | Gene: | CG30156 / 246488 | FlyBaseID: | FBgn0050156 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005166271.1 | Gene: | dnajc16 / 559762 | ZFINID: | ZDB-GENE-130530-683 | Length: | 777 | Species: | Danio rerio |
Alignment Length: | 210 | Identity: | 51/210 - (24%) |
---|---|---|---|
Similarity: | 77/210 - (36%) | Gaps: | 76/210 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 YEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAV 162
Fly 163 GDCHDQDPSQYKD----------YRGES----EFNEANGNDLG-----------------AAFRR 196
Fly 197 PYR-------------------------------------GANQRMPQRQSLYQTQQLVIGVVAA 224
Fly 225 LVFLF----VTMHFI 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30156 | NP_001260752.1 | DnaJ | 96..157 | CDD:278647 | 24/58 (41%) |
DUF1977 | 237..334 | CDD:286411 | |||
dnajc16 | XP_005166271.1 | DnaJ | 29..90 | CDD:278647 | 24/58 (41%) |
TRX_DnaJ | 133..242 | CDD:239261 | 17/105 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |