DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnajc16

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_005166271.1 Gene:dnajc16 / 559762 ZFINID:ZDB-GENE-130530-683 Length:777 Species:Danio rerio


Alignment Length:210 Identity:51/210 - (24%)
Similarity:77/210 - (36%) Gaps:76/210 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAV 162
            |:||.::..|:.:|:|:.|.:||...||||||:|.||..|.:|:::.:.||:.:||..|:   ..
Zfish    31 YKVLGVTRSASQAEIKKVYKRLAKEWHPDKNKNPEAEDMFIKITKSYEILTNEEKRASYD---RY 92

  Fly   163 GDCHDQDPSQYKD----------YRGES----EFNEANGNDLG-----------------AAFRR 196
            |...|..|..::.          |..||    .||...|.|..                 .:|:|
Zfish    93 GQTDDTQPYGHRHHGFRHFHDNFYFDESFFHFPFNNKGGRDFADSKYTLHFNQYVNEVVPDSFKR 157

  Fly   197 PYR-------------------------------------GANQRMPQRQSLYQTQQLVIGVVAA 224
            ||.                                     |..:|:......:||.. ::|||..
Zfish   158 PYLIKITSDWCFSCIHIEPVWKETVQELETLGIGIGVVDVGYERRLANHLGAHQTPS-ILGVVNG 221

  Fly   225 LVFLF----VTMHFI 235
            .|..|    |..|.|
Zfish   222 KVSFFHYAVVKEHLI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 24/58 (41%)
DUF1977 237..334 CDD:286411
dnajc16XP_005166271.1 DnaJ 29..90 CDD:278647 24/58 (41%)
TRX_DnaJ 133..242 CDD:239261 17/105 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.