DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnajc10

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001077016.1 Gene:dnajc10 / 557858 ZFINID:ZDB-GENE-070327-1 Length:791 Species:Danio rerio


Alignment Length:282 Identity:62/282 - (21%)
Similarity:101/282 - (35%) Gaps:89/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PTRKSDALPHKFTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGA 133
            |:|||  |...|....|.|  .:....::|::|.||..|:..::::|:.||||.:|||||  |..
Zfish    10 PSRKS--LLFAFIAVWLFV--SISSDEDYYKLLGISREASTRDIRQAFKKLALTMHPDKN--PND 68

  Fly   134 EQA---FRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPSQYKD----------YRGESEFNEA 185
            |.|   |.:|:.|.:.|.|...|.:|:.....|...:|...:|:.          |..:.|....
Zfish    69 ETAHDKFLKINRAYEVLKDEDLRKKYDKYGEKGLQDEQQGGRYESWNYYRYDFGIYDDDPEITTL 133

  Fly   186 NGNDLGAAFRRPYRGANQRMPQRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHS 250
            :..|..||...                       |.|     .||..:|...:..:....|....
Zfish   134 DRGDFDAAVNS-----------------------GEV-----WFVNFYFPRCSHCHDLAPTWREF 170

  Fly   251 ARR-----------------LSRTNHIAYY---------MNPTTLSKY----TEQQLAELEVEIE 285
            |:.                 |.|:..|..|         |||   .||    |:..|.:..::..
Zfish   171 AKEMDGVIRIGAVNCGDNGMLCRSKGINSYPSLYVFRAGMNP---EKYFNDRTKSSLTKFAMQFV 232

  Fly   286 EVYISDLKHKCRQERSWRDNLF 307
            :..:::|         |:.|::
Zfish   233 KSKVTEL---------WQGNIY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 24/63 (38%)
DUF1977 237..334 CDD:286411 16/101 (16%)
dnajc10NP_001077016.1 DnaJ 33..>129 CDD:223560 29/97 (30%)
DnaJ 33..95 CDD:278647 24/63 (38%)
PDI_a_ERdj5_N 128..228 CDD:239301 22/130 (17%)
ER_PDI_fam 129..648 CDD:273457 25/157 (16%)
Thioredoxin_like <276..318 CDD:294274
PDI_a_family 348..443 CDD:239259
PDI_a_ERdj5_C 450..546 CDD:239302
PDI_a_ERdj5_C 552..660 CDD:239302
PDI_a_ERdj5_C 666..772 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.