DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnajc3

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_012812335.1 Gene:dnajc3 / 496977 XenbaseID:XB-GENE-997043 Length:504 Species:Xenopus tropicalis


Alignment Length:211 Identity:56/211 - (26%)
Similarity:90/211 - (42%) Gaps:43/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILQARRHHCVDKVVSDLCLGHYEHALRQINEDLEGLQNHDEIMALLELKNIILRLRLKGEAQR-- 65
            ::|.|..||..|....      ..|:|...|.|:  |..:.:.||.:.....:...:..||.|  
 Frog   307 LVQERSCHCYSKSQQS------TEAIRVCTEFLQ--QEPNNVNALKDRAEAYILEEMYEEAIRDY 363

  Fly    66 -TIGPTRKSDALPHKFTLEMLDVVQKVLR---CRNHYEVLRISHHATYSEVKRAYHKLALRLHP- 125
             |.....::|    |...|.||..||:|:   .|::|::|.:..:|...|:.:||.|||.:.|| 
 Frog   364 ETAQQNNEND----KQIREGLDKAQKLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLAQQWHPD 424

  Fly   126 ---DKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANG 187
               |:.:...||:.|..|:.|.:.|||.:||..::..        :||...:..:|..       
 Frog   425 NFQDEEEKKKAEKKFIDIASAKEVLTDPEKRSRFDAG--------EDPLDPESQQGAG------- 474

  Fly   188 NDLGAAFRRPYRGANQ 203
               |..|   :||.||
 Frog   475 ---GPHF---HRGWNQ 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 22/64 (34%)
DUF1977 237..334 CDD:286411
dnajc3XP_012812335.1 TPR repeat 37..65 CDD:276809
PEP_TPR_lipo 47..>366 CDD:274350 15/66 (23%)
TPR repeat 70..100 CDD:276809
TPR repeat 105..133 CDD:276809
TPR repeat 154..182 CDD:276809
TPR repeat 187..217 CDD:276809
TPR repeat 222..250 CDD:276809
TPR repeat 256..281 CDD:276809
TPR repeat 300..335 CDD:276809 9/35 (26%)
TPR repeat 340..368 CDD:276809 6/27 (22%)
TPR repeat 374..397 CDD:276809 8/22 (36%)
DnaJ 392..>494 CDD:223560 32/114 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.