Sequence 1: | NP_001260752.1 | Gene: | CG30156 / 246488 | FlyBaseID: | FBgn0050156 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012812335.1 | Gene: | dnajc3 / 496977 | XenbaseID: | XB-GENE-997043 | Length: | 504 | Species: | Xenopus tropicalis |
Alignment Length: | 211 | Identity: | 56/211 - (26%) |
---|---|---|---|
Similarity: | 90/211 - (42%) | Gaps: | 43/211 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 ILQARRHHCVDKVVSDLCLGHYEHALRQINEDLEGLQNHDEIMALLELKNIILRLRLKGEAQR-- 65
Fly 66 -TIGPTRKSDALPHKFTLEMLDVVQKVLR---CRNHYEVLRISHHATYSEVKRAYHKLALRLHP- 125
Fly 126 ---DKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANG 187
Fly 188 NDLGAAFRRPYRGANQ 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30156 | NP_001260752.1 | DnaJ | 96..157 | CDD:278647 | 22/64 (34%) |
DUF1977 | 237..334 | CDD:286411 | |||
dnajc3 | XP_012812335.1 | TPR repeat | 37..65 | CDD:276809 | |
PEP_TPR_lipo | 47..>366 | CDD:274350 | 15/66 (23%) | ||
TPR repeat | 70..100 | CDD:276809 | |||
TPR repeat | 105..133 | CDD:276809 | |||
TPR repeat | 154..182 | CDD:276809 | |||
TPR repeat | 187..217 | CDD:276809 | |||
TPR repeat | 222..250 | CDD:276809 | |||
TPR repeat | 256..281 | CDD:276809 | |||
TPR repeat | 300..335 | CDD:276809 | 9/35 (26%) | ||
TPR repeat | 340..368 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 374..397 | CDD:276809 | 8/22 (36%) | ||
DnaJ | 392..>494 | CDD:223560 | 32/114 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |