powered by:
Protein Alignment CG30156 and dnajb6a
DIOPT Version :9
Sequence 1: | NP_001260752.1 |
Gene: | CG30156 / 246488 |
FlyBaseID: | FBgn0050156 |
Length: | 358 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002353.1 |
Gene: | dnajb6a / 436626 |
ZFINID: | ZDB-GENE-040718-45 |
Length: | 316 |
Species: | Danio rerio |
Alignment Length: | 140 |
Identity: | 43/140 - (30%) |
Similarity: | 62/140 - (44%) |
Gaps: | 38/140 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN--KSPGAEQAFRRISEAADCLTDCQKRIEYNI 158
::|:||.:...|:..::|:||.|||||.||||| ....||:.|:.:|||.:.|:|..||..|:.
Zfish 3 DYYQVLGVQKTASPDDIKKAYRKLALRWHPDKNPDNKEDAEKKFKELSEAYEVLSDANKRSLYDR 67
Fly 159 ATAVG---------DCH--------------------DQDPSQYKDYRGESEFNEANGNDLGAAF 194
....| :.| .||| :.|:.|...| |:|....
Zfish 68 YGKEGLTPGGGGGREHHFGGGGFTFRNPEDVFREFFGGQDP--FADFFGADPF----GDDFFGG- 125
Fly 195 RRPYRGANQR 204
||.|...:||
Zfish 126 RRHYHHHHQR 135
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30156 | NP_001260752.1 |
DnaJ |
96..157 |
CDD:278647 |
27/62 (44%) |
DUF1977 |
237..334 |
CDD:286411 |
|
dnajb6a | NP_001002353.1 |
DnaJ |
3..66 |
CDD:278647 |
27/62 (44%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170589199 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.