DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and DNAJB9

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_036460.1 Gene:DNAJB9 / 4189 HGNCID:6968 Length:223 Species:Homo sapiens


Alignment Length:154 Identity:45/154 - (29%)
Similarity:76/154 - (49%) Gaps:35/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAA 144
            |.:.:|.:.:.:|..:::|::|.:...|:..::|:|:||||::.||||||||.||..||.|:||.
Human    10 FAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAY 74

  Fly   145 DCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANG-NDLGAAFRRPYR--------- 199
            :.|:|..:|.||                  |..|.|.|....| ...|::|.:.:.         
Human    75 ETLSDANRRKEY------------------DTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKD 121

  Fly   200 ----GANQRMPQR---QSLYQTQQ 216
                |.||....:   ::.:||:|
Human   122 FGFFGQNQNTGSKKRFENHFQTRQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 28/60 (47%)
DUF1977 237..334 CDD:286411
DNAJB9NP_036460.1 type 2 signal-anchor for ER localization 7..23 2/12 (17%)
DnaJ 26..>136 CDD:333066 39/127 (31%)
Divergent targeting domain. /evidence=ECO:0000250|UniProtKB:Q9QYI6 91..223 11/55 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.