DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and CG8476

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_731777.1 Gene:CG8476 / 41624 FlyBaseID:FBgn0038127 Length:242 Species:Drosophila melanogaster


Alignment Length:151 Identity:41/151 - (27%)
Similarity:64/151 - (42%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ILRLRLKGEAQRTIGPTRKSDALPHKFTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHK 118
            :||....|..|    |.|.......:||.:...:.|  ||..|||:||.:...::..|:|||:.:
  Fly     1 MLRTIQTGAGQ----PVRCLATFGSRFTYQSQPMSQ--LRAENHYQVLNVPVGSSDREIKRAFIE 59

  Fly   119 LALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPS-QYKDYRGE--- 179
            |:.:.|||.|......:.|.:|.||...|.....|..|:....:   .:|:.| |...:.|.   
  Fly    60 LSKKYHPDANSQTRDSEVFMKICEAYQTLHRVNSRQIYDSRLRM---QNQNKSPQESTFTGRRVY 121

  Fly   180 ---SEFNEA-NGNDLGAAFRR 196
               |::..| ....:|...||
  Fly   122 TVWSQYQSAVRSKQMGRGSRR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 20/60 (33%)
DUF1977 237..334 CDD:286411
CG8476NP_731777.1 DnaJ 37..98 CDD:278647 20/60 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.