DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and CG7130

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster


Alignment Length:77 Identity:29/77 - (37%)
Similarity:47/77 - (61%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIA 159
            :::|::|.|..:|:..:||:.|.::|||.|||||..|.||:.||.:..|.:.|.|.:||..|:..
  Fly     3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQH 67

  Fly   160 TAVGDCHDQDPS 171
            ...|...|.:|:
  Fly    68 GEEGLKCDDEPA 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 29/77 (38%)
DnaJ 96..157 CDD:395170 25/60 (42%)
DUF1977 238..334 CDD:462754
CG7130NP_649380.1 DnaJ_bact 4..>73 CDD:274090 27/68 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.