DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and CG7133

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster


Alignment Length:113 Identity:42/113 - (37%)
Similarity:58/113 - (51%) Gaps:21/113 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 MLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLT 148
            |.||.:      :||:||.:..:||.||:|.|:.:|:|:.|||||:. ||:: |.||:||...|.
  Fly     1 MSDVYE------DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED-GAKE-FLRINEAHRVLI 57

  Fly   149 DCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANGN--DLGAAF 194
            |.|:|..|       ||..|.    .|.........|||.  :||..|
  Fly    58 DHQRRALY-------DCCFQS----MDVEAIIPAENANGQLPELGNPF 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 39/102 (38%)
DnaJ 96..157 CDD:395170 28/60 (47%)
DUF1977 238..334 CDD:462754
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 29/67 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.