DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and DnaJ-60

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster


Alignment Length:175 Identity:46/175 - (26%)
Similarity:69/175 - (39%) Gaps:47/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HYEVLRISHHATYSEVKRAYHKLALRLHPDKNKS---PGAEQAFRRISEAADCLTDCQKRIEYNI 158
            |||||.|.:..:..||:.|:.:|:...|||...:   |.....|.:||||...|...::|.:|:.
  Fly    27 HYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRRDYDD 91

  Fly   159 A----------TAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGANQRMPQRQSLYQ 213
            :          :.||:  ..:|.|..|.|...:.|..           ||.|.  |..:|.|.:|
  Fly    92 SLLWQPSRSDRSPVGE--TVNPGQAWDVRPNYDPNPG-----------PYYGI--RGLKRVSNWQ 141

  Fly   214 TQ--QLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSR 256
            ..  .:.:|.|.||                 |..|...|:.:|||
  Fly   142 VAVVLMALGFVGAL-----------------FGFTSVRSSFKLSR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 21/62 (34%)
DUF1977 237..334 CDD:286411 6/20 (30%)
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:278647 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.