DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and DNAJB13

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:253 Identity:55/253 - (21%)
Similarity:97/253 - (38%) Gaps:64/253 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 HATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYN----------IAT 160
            |:|..:..:.|.:|||:.||.|:..|.:.:.||:|:||.|.|:|..||..|:          |..
Human    48 HSTAEDKDQRYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGLKGGIPL 112

  Fly   161 AVGD---------CHDQDPSQYKDYRGE----SEFNEANGNDLGAAF-RRPYRGANQRMPQ-RQS 210
            ..|.         .|.:....:.::.|.    |||.:|.|:::...| ....||..::.|| .:.
Human   113 EFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERD 177

  Fly   211 LYQ---------TQQLVI--------GVVAALVFLFVTMHFIAG-------------------AP 239
            ||.         |:::.|        |..:.:....:|:....|                   .|
Human   178 LYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIP 242

  Fly   240 AYSFTLTRTHSARRLSRTNHIAYYMNPTTLSK---YTEQQLAELEVEIEEVYISDLKH 294
            |....:.:.....|..|.|...:::||..|.|   ....::..|:..:..:.|:|:.|
Human   243 ADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 20/50 (40%)
DUF1977 237..334 CDD:286411 14/80 (18%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 55/253 (22%)
DnaJ 48..99 CDD:278647 20/50 (40%)
DnaJ_C 174..336 CDD:199909 20/127 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.