DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and mrj

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:144 Identity:44/144 - (30%)
Similarity:67/144 - (46%) Gaps:27/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKS--PGAEQAFRRISEAADCLTDCQKRIEYNI 158
            ::|::|.:|..||.||||:||.||||:.|||||..  ..|.:.||.:|||.:.|:|.:||..|:.
  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67

  Fly   159 ATAV-----GDCHDQDPSQYKDYRGESEFNEANGNDLG-AAFRRPY-----------RGANQRMP 206
            ...:     ......:.|.|..||        ||...| :::.|.|           .|:.:|..
  Fly    68 RATLHKSSNSGSSSSNSSSYTRYR--------NGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSG 124

  Fly   207 QRQSLYQTQQLVIG 220
            .|...:..:.:..|
  Fly   125 NRYQAFTFRNIFEG 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 30/62 (48%)
DUF1977 237..334 CDD:286411
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 30/62 (48%)
DnaJ 3..66 CDD:278647 30/62 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.