DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and CG8531

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:73 Identity:25/73 - (34%)
Similarity:37/73 - (50%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPG----AEQAFRRISEAADCLTDCQKRIEY 156
            |:|..|.:...||..::..||.|.:...||||:..|.    ||..|.|...|.:.|:|.|:|..|
  Fly    15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIY 79

  Fly   157 NIATAVGD 164
            :   :||:
  Fly    80 D---SVGE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 22/64 (34%)
DUF1977 237..334 CDD:286411
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 25/73 (34%)
DnaJ 15..80 CDD:278647 22/64 (34%)
DUF3395 409..538 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.